Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1403200..1404116 | Replicon | chromosome |
Accession | NZ_OX419652 | ||
Organism | Bacillus subtilis isolate NRS6131 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | KJP56_RS07360 | Protein ID | WP_015715744.1 |
Coordinates | 1403370..1404116 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP56_RS07355 | Protein ID | WP_003232646.1 |
Coordinates | 1403200..1403370 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP56_RS07310 (1398432) | 1398432..1399010 | + | 579 | WP_015483131.1 | YmfQ family protein | - |
KJP56_RS07315 (1399007) | 1399007..1399279 | + | 273 | WP_003232665.1 | hypothetical protein | - |
KJP56_RS07320 (1399282) | 1399282..1399611 | + | 330 | Protein_1378 | terminase | - |
KJP56_RS07325 (1400775) | 1400775..1401236 | + | 462 | WP_072174134.1 | hypothetical protein | - |
KJP56_RS07330 (1401226) | 1401226..1401417 | + | 192 | WP_080375511.1 | phage portal protein | - |
KJP56_RS07335 (1401489) | 1401489..1401758 | + | 270 | WP_072174140.1 | hemolysin XhlA family protein | - |
KJP56_RS07340 (1401771) | 1401771..1402034 | + | 264 | WP_014479566.1 | phage holin | - |
KJP56_RS07345 (1402047) | 1402047..1402940 | + | 894 | WP_163117447.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP56_RS07350 (1402977) | 1402977..1403114 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP56_RS07355 (1403200) | 1403200..1403370 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP56_RS07360 (1403370) | 1403370..1404116 | - | 747 | WP_015715744.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP56_RS07365 (1404226) | 1404226..1405227 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP56_RS07370 (1405240) | 1405240..1405857 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP56_RS07375 (1406133) | 1406133..1407449 | - | 1317 | WP_128740275.1 | serine/threonine exchanger | - |
KJP56_RS07380 (1407838) | 1407838..1408788 | + | 951 | WP_015252261.1 | ring-cleaving dioxygenase | - |
KJP56_RS07385 (1408889) | 1408889..1409036 | + | 148 | Protein_1391 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29043.47 Da Isoelectric Point: 4.6191
>T296950 WP_015715744.1 NZ_OX419652:c1404116-1403370 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHIYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHIYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|