Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 564578..565214 | Replicon | chromosome |
Accession | NZ_OX419652 | ||
Organism | Bacillus subtilis isolate NRS6131 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP56_RS02980 | Protein ID | WP_003156187.1 |
Coordinates | 564864..565214 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP56_RS02975 | Protein ID | WP_003225183.1 |
Coordinates | 564578..564859 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP56_RS02955 (560937) | 560937..561536 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
KJP56_RS02960 (561631) | 561631..561996 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
KJP56_RS02965 (562162) | 562162..563178 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP56_RS02970 (563293) | 563293..564462 | + | 1170 | WP_015252766.1 | alanine racemase | - |
KJP56_RS02975 (564578) | 564578..564859 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP56_RS02980 (564864) | 564864..565214 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP56_RS02985 (565330) | 565330..566154 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP56_RS02990 (566159) | 566159..566524 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP56_RS02995 (566528) | 566528..566929 | + | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
KJP56_RS03000 (566941) | 566941..567948 | + | 1008 | WP_213419561.1 | PP2C family protein-serine/threonine phosphatase | - |
KJP56_RS03005 (568017) | 568017..568346 | + | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
KJP56_RS03010 (568343) | 568343..568825 | + | 483 | WP_021481702.1 | anti-sigma B factor RsbW | - |
KJP56_RS03015 (568791) | 568791..569579 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP56_RS03020 (569579) | 569579..570178 | + | 600 | WP_095252677.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296949 WP_003156187.1 NZ_OX419652:564864-565214 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|