Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1396973..1397889 | Replicon | chromosome |
Accession | NZ_OX419580 | ||
Organism | Bacillus subtilis isolate NRS6116 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP60_RS07465 | Protein ID | WP_003244695.1 |
Coordinates | 1397143..1397889 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP60_RS07460 | Protein ID | WP_003232646.1 |
Coordinates | 1396973..1397143 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP60_RS07425 (1393836) | 1393836..1394165 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP60_RS07430 (1394162) | 1394162..1394326 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP60_RS07435 (1394370) | 1394370..1395209 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP60_RS07440 (1395262) | 1395262..1395531 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP60_RS07445 (1395544) | 1395544..1395807 | + | 264 | WP_003232653.1 | phage holin | - |
KJP60_RS07450 (1395820) | 1395820..1396713 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP60_RS07455 (1396750) | 1396750..1396887 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP60_RS07460 (1396973) | 1396973..1397143 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP60_RS07465 (1397143) | 1397143..1397889 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP60_RS07470 (1397999) | 1397999..1399000 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP60_RS07475 (1399013) | 1399013..1399630 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP60_RS07480 (1399906) | 1399906..1401222 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP60_RS07485 (1401611) | 1401611..1402561 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP60_RS07490 (1402662) | 1402662..1402808 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1362981..1406309 | 43328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296929 WP_003244695.1 NZ_OX419580:c1397889-1397143 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|