Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 567185..567821 | Replicon | chromosome |
Accession | NZ_OX419580 | ||
Organism | Bacillus subtilis isolate NRS6116 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP60_RS03015 | Protein ID | WP_003156187.1 |
Coordinates | 567471..567821 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP60_RS03010 | Protein ID | WP_003225183.1 |
Coordinates | 567185..567466 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP60_RS02990 (563544) | 563544..564143 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP60_RS02995 (564238) | 564238..564603 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
KJP60_RS03000 (564769) | 564769..565785 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP60_RS03005 (565900) | 565900..567069 | + | 1170 | WP_003234284.1 | alanine racemase | - |
KJP60_RS03010 (567185) | 567185..567466 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP60_RS03015 (567471) | 567471..567821 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP60_RS03020 (567936) | 567936..568760 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP60_RS03025 (568765) | 568765..569130 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP60_RS03030 (569134) | 569134..569535 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP60_RS03035 (569547) | 569547..570554 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP60_RS03040 (570616) | 570616..570945 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP60_RS03045 (570942) | 570942..571424 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP60_RS03050 (571390) | 571390..572178 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP60_RS03055 (572178) | 572178..572777 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296928 WP_003156187.1 NZ_OX419580:567471-567821 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|