Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1320227..1321143 | Replicon | chromosome |
Accession | NZ_OX419579 | ||
Organism | Bacillus subtilis isolate NRS6103 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP43_RS06945 | Protein ID | WP_003244695.1 |
Coordinates | 1320397..1321143 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP43_RS06940 | Protein ID | WP_003232646.1 |
Coordinates | 1320227..1320397 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP43_RS06905 (1317093) | 1317093..1317419 | + | 327 | WP_029727046.1 | XkdW family protein | - |
KJP43_RS06910 (1317416) | 1317416..1317580 | + | 165 | WP_014479563.1 | XkdX family protein | - |
KJP43_RS06915 (1317624) | 1317624..1318463 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
KJP43_RS06920 (1318516) | 1318516..1318785 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
KJP43_RS06925 (1318798) | 1318798..1319061 | + | 264 | WP_014479566.1 | phage holin | - |
KJP43_RS06930 (1319074) | 1319074..1319967 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP43_RS06935 (1320004) | 1320004..1320141 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP43_RS06940 (1320227) | 1320227..1320397 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP43_RS06945 (1320397) | 1320397..1321143 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP43_RS06950 (1321253) | 1321253..1322254 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP43_RS06955 (1322267) | 1322267..1322884 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP43_RS06960 (1323160) | 1323160..1324476 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
KJP43_RS06965 (1324864) | 1324864..1325814 | + | 951 | WP_003232637.1 | VOC family protein | - |
KJP43_RS06970 (1325923) | 1325923..1326018 | + | 96 | Protein_1309 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296914 WP_003244695.1 NZ_OX419579:c1321143-1320397 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|