Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 516722..517358 | Replicon | chromosome |
| Accession | NZ_OX419579 | ||
| Organism | Bacillus subtilis isolate NRS6103 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | KJP43_RS02640 | Protein ID | WP_003156187.1 |
| Coordinates | 517008..517358 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | KJP43_RS02635 | Protein ID | WP_003225183.1 |
| Coordinates | 516722..517003 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP43_RS02615 (513082) | 513082..513681 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
| KJP43_RS02620 (513776) | 513776..514141 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
| KJP43_RS02625 (514307) | 514307..515323 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
| KJP43_RS02630 (515437) | 515437..516606 | + | 1170 | WP_029727188.1 | alanine racemase | - |
| KJP43_RS02635 (516722) | 516722..517003 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| KJP43_RS02640 (517008) | 517008..517358 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| KJP43_RS02645 (517473) | 517473..518297 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| KJP43_RS02650 (518302) | 518302..518667 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| KJP43_RS02655 (518671) | 518671..519072 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
| KJP43_RS02660 (519084) | 519084..520091 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| KJP43_RS02665 (520153) | 520153..520482 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| KJP43_RS02670 (520479) | 520479..520961 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| KJP43_RS02675 (520927) | 520927..521715 | + | 789 | WP_029727187.1 | RNA polymerase sigma factor SigB | - |
| KJP43_RS02680 (521715) | 521715..522314 | + | 600 | WP_003234303.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296913 WP_003156187.1 NZ_OX419579:517008-517358 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|