Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1308137..1309053 | Replicon | chromosome |
Accession | NZ_OX419578 | ||
Organism | Bacillus subtilis isolate NRS6128 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP45_RS06880 | Protein ID | WP_003244695.1 |
Coordinates | 1308307..1309053 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP45_RS06875 | Protein ID | WP_003232646.1 |
Coordinates | 1308137..1308307 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP45_RS06840 (NRS6128_06775) | 1304997..1305326 | + | 330 | WP_080529228.1 | XkdW family protein | - |
KJP45_RS06845 (NRS6128_06780) | 1305323..1305487 | + | 165 | WP_047182493.1 | XkdX family protein | - |
KJP45_RS06850 (NRS6128_06785) | 1305534..1306373 | + | 840 | WP_029317677.1 | phage-like element PBSX protein XepA | - |
KJP45_RS06855 (NRS6128_06790) | 1306426..1306695 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP45_RS06860 (NRS6128_06795) | 1306708..1306971 | + | 264 | WP_029317678.1 | phage holin | - |
KJP45_RS06865 (NRS6128_06800) | 1306984..1307877 | + | 894 | WP_029317679.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP45_RS06870 (NRS6128_06805) | 1307914..1308051 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP45_RS06875 (NRS6128_06810) | 1308137..1308307 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP45_RS06880 (NRS6128_06815) | 1308307..1309053 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP45_RS06885 (NRS6128_06820) | 1309163..1310164 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP45_RS06890 (NRS6128_06825) | 1310177..1310794 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP45_RS06895 (NRS6128_06830) | 1311070..1312386 | - | 1317 | WP_080529229.1 | serine/threonine exchanger | - |
KJP45_RS06900 (NRS6128_06835) | 1312770..1313720 | + | 951 | WP_213414432.1 | ring-cleaving dioxygenase | - |
KJP45_RS06905 | 1313830..1313931 | + | 102 | Protein_1296 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296912 WP_003244695.1 NZ_OX419578:c1309053-1308307 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|