Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 513320..513956 | Replicon | chromosome |
Accession | NZ_OX419578 | ||
Organism | Bacillus subtilis isolate NRS6128 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP45_RS02630 | Protein ID | WP_003156187.1 |
Coordinates | 513606..513956 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP45_RS02625 | Protein ID | WP_003225183.1 |
Coordinates | 513320..513601 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP45_RS02605 (NRS6128_02580) | 509679..510278 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP45_RS02610 (NRS6128_02585) | 510373..510738 | + | 366 | WP_014475874.1 | holo-ACP synthase | - |
KJP45_RS02615 (NRS6128_02590) | 510904..511920 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP45_RS02620 (NRS6128_02595) | 512035..513204 | + | 1170 | WP_213414867.1 | alanine racemase | - |
KJP45_RS02625 (NRS6128_02600) | 513320..513601 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP45_RS02630 (NRS6128_02605) | 513606..513956 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP45_RS02635 (NRS6128_02610) | 514071..514895 | + | 825 | WP_015252765.1 | RsbT co-antagonist protein RsbRA | - |
KJP45_RS02640 (NRS6128_02615) | 514900..515265 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP45_RS02645 (NRS6128_02620) | 515269..515670 | + | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
KJP45_RS02650 (NRS6128_02625) | 515682..516689 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP45_RS02655 (NRS6128_02630) | 516751..517080 | + | 330 | WP_213414866.1 | anti-sigma factor antagonist | - |
KJP45_RS02660 (NRS6128_02635) | 517077..517559 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP45_RS02665 (NRS6128_02640) | 517525..518313 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP45_RS02670 (NRS6128_02645) | 518313..518912 | + | 600 | WP_003234303.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296911 WP_003156187.1 NZ_OX419578:513606-513956 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|