Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1342864..1343780 | Replicon | chromosome |
Accession | NZ_OX419577 | ||
Organism | Bacillus subtilis isolate NRS6120 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP47_RS07030 | Protein ID | WP_003244695.1 |
Coordinates | 1343034..1343780 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP47_RS07025 | Protein ID | WP_003232646.1 |
Coordinates | 1342864..1343034 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP47_RS06990 (1339726) | 1339726..1340055 | + | 330 | WP_017695120.1 | XkdW family protein | - |
KJP47_RS06995 (1340052) | 1340052..1340216 | + | 165 | WP_213383475.1 | XkdX family protein | - |
KJP47_RS07000 (1340260) | 1340260..1341099 | + | 840 | WP_213383476.1 | phage-like element PBSX protein XepA | - |
KJP47_RS07005 (1341152) | 1341152..1341421 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
KJP47_RS07010 (1341434) | 1341434..1341697 | + | 264 | WP_003232653.1 | phage holin | - |
KJP47_RS07015 (1341710) | 1341710..1342603 | + | 894 | WP_014479567.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP47_RS07020 (1342641) | 1342641..1342778 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP47_RS07025 (1342864) | 1342864..1343034 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP47_RS07030 (1343034) | 1343034..1343780 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP47_RS07035 (1343889) | 1343889..1344890 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
KJP47_RS07040 (1344903) | 1344903..1345520 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP47_RS07045 (1345796) | 1345796..1347112 | - | 1317 | WP_213383477.1 | amino acid permease | - |
KJP47_RS07050 (1347501) | 1347501..1348451 | + | 951 | WP_213383478.1 | ring-cleaving dioxygenase | - |
KJP47_RS07055 (1348551) | 1348551..1348697 | + | 147 | WP_121591715.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296901 WP_003244695.1 NZ_OX419577:c1343780-1343034 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|