Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 519968..520604 | Replicon | chromosome |
Accession | NZ_OX419577 | ||
Organism | Bacillus subtilis isolate NRS6120 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP47_RS02665 | Protein ID | WP_003156187.1 |
Coordinates | 520254..520604 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP47_RS02660 | Protein ID | WP_003225183.1 |
Coordinates | 519968..520249 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP47_RS02640 (516328) | 516328..516927 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP47_RS02645 (517022) | 517022..517387 | + | 366 | WP_014478897.1 | holo-ACP synthase | - |
KJP47_RS02650 (517553) | 517553..518569 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP47_RS02655 (518683) | 518683..519852 | + | 1170 | WP_014478898.1 | alanine racemase | - |
KJP47_RS02660 (519968) | 519968..520249 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP47_RS02665 (520254) | 520254..520604 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP47_RS02670 (520709) | 520709..521533 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP47_RS02675 (521538) | 521538..521903 | + | 366 | WP_043858089.1 | RsbT antagonist protein RsbS | - |
KJP47_RS02680 (521907) | 521907..522308 | + | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
KJP47_RS02685 (522320) | 522320..523327 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP47_RS02690 (523389) | 523389..523718 | + | 330 | WP_014662855.1 | anti-sigma factor antagonist RsbV | - |
KJP47_RS02695 (523715) | 523715..524197 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP47_RS02700 (524163) | 524163..524951 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP47_RS02705 (524951) | 524951..525550 | + | 600 | WP_003234303.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296900 WP_003156187.1 NZ_OX419577:520254-520604 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|