Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1324782..1325698 | Replicon | chromosome |
| Accession | NZ_OX419576 | ||
| Organism | Bacillus subtilis isolate NRS6105 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | KJP51_RS06940 | Protein ID | WP_003244695.1 |
| Coordinates | 1324952..1325698 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | KJP51_RS06935 | Protein ID | WP_003232646.1 |
| Coordinates | 1324782..1324952 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP51_RS06900 (NRS6105_06830) | 1321645..1321974 | + | 330 | WP_003232660.1 | XkdW family protein | - |
| KJP51_RS06905 (NRS6105_06835) | 1321971..1322135 | + | 165 | WP_003232658.1 | XkdX family protein | - |
| KJP51_RS06910 (NRS6105_06840) | 1322179..1323018 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
| KJP51_RS06915 (NRS6105_06845) | 1323071..1323340 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| KJP51_RS06920 (NRS6105_06850) | 1323353..1323616 | + | 264 | WP_003232653.1 | phage holin | - |
| KJP51_RS06925 (NRS6105_06855) | 1323629..1324522 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KJP51_RS06930 | 1324559..1324696 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| KJP51_RS06935 (NRS6105_06860) | 1324782..1324952 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| KJP51_RS06940 (NRS6105_06865) | 1324952..1325698 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| KJP51_RS06945 (NRS6105_06870) | 1325808..1326809 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| KJP51_RS06950 (NRS6105_06875) | 1326822..1327439 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| KJP51_RS06955 (NRS6105_06880) | 1327715..1329031 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
| KJP51_RS06960 (NRS6105_06885) | 1329420..1330370 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| KJP51_RS06965 | 1330479..1330574 | + | 96 | Protein_1308 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296897 WP_003244695.1 NZ_OX419576:c1325698-1324952 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|