Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 517225..517861 | Replicon | chromosome |
Accession | NZ_OX419576 | ||
Organism | Bacillus subtilis isolate NRS6105 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP51_RS02635 | Protein ID | WP_003156187.1 |
Coordinates | 517511..517861 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP51_RS02630 | Protein ID | WP_003225183.1 |
Coordinates | 517225..517506 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP51_RS02610 (NRS6105_02595) | 513584..514183 | - | 600 | WP_032722928.1 | rhomboid family intramembrane serine protease | - |
KJP51_RS02615 (NRS6105_02600) | 514278..514643 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
KJP51_RS02620 (NRS6105_02605) | 514809..515825 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP51_RS02625 (NRS6105_02610) | 515940..517109 | + | 1170 | WP_032722929.1 | alanine racemase | - |
KJP51_RS02630 (NRS6105_02615) | 517225..517506 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP51_RS02635 (NRS6105_02620) | 517511..517861 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP51_RS02640 (NRS6105_02625) | 517977..518801 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP51_RS02645 (NRS6105_02630) | 518806..519171 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP51_RS02650 (NRS6105_02635) | 519175..519576 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP51_RS02655 (NRS6105_02640) | 519588..520595 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP51_RS02660 (NRS6105_02645) | 520657..520986 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP51_RS02665 (NRS6105_02650) | 520983..521465 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP51_RS02670 (NRS6105_02655) | 521431..522219 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP51_RS02675 (NRS6105_02660) | 522219..522818 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296896 WP_003156187.1 NZ_OX419576:517511-517861 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|