Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1329606..1330522 | Replicon | chromosome |
Accession | NZ_OX419575 | ||
Organism | Bacillus subtilis isolate NRS6121 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP52_RS06980 | Protein ID | WP_003244695.1 |
Coordinates | 1329776..1330522 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP52_RS06975 | Protein ID | WP_003232646.1 |
Coordinates | 1329606..1329776 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP52_RS06940 (1326469) | 1326469..1326798 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP52_RS06945 (1326795) | 1326795..1326959 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP52_RS06950 (1327003) | 1327003..1327842 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP52_RS06955 (1327895) | 1327895..1328164 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP52_RS06960 (1328177) | 1328177..1328440 | + | 264 | WP_003232653.1 | phage holin | - |
KJP52_RS06965 (1328453) | 1328453..1329346 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP52_RS06970 (1329383) | 1329383..1329520 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP52_RS06975 (1329606) | 1329606..1329776 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP52_RS06980 (1329776) | 1329776..1330522 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP52_RS06985 (1330632) | 1330632..1331633 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP52_RS06990 (1331646) | 1331646..1332263 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP52_RS06995 (1332539) | 1332539..1333855 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP52_RS07000 (1334244) | 1334244..1335194 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP52_RS07005 (1335295) | 1335295..1335441 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296889 WP_003244695.1 NZ_OX419575:c1330522-1329776 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|