Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 518253..518889 | Replicon | chromosome |
Accession | NZ_OX419575 | ||
Organism | Bacillus subtilis isolate NRS6121 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP52_RS02650 | Protein ID | WP_003156187.1 |
Coordinates | 518539..518889 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP52_RS02645 | Protein ID | WP_003225183.1 |
Coordinates | 518253..518534 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP52_RS02625 (514612) | 514612..515211 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP52_RS02630 (515306) | 515306..515671 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
KJP52_RS02635 (515837) | 515837..516853 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP52_RS02640 (516968) | 516968..518137 | + | 1170 | WP_003234284.1 | alanine racemase | - |
KJP52_RS02645 (518253) | 518253..518534 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP52_RS02650 (518539) | 518539..518889 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP52_RS02655 (519004) | 519004..519828 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP52_RS02660 (519833) | 519833..520198 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP52_RS02665 (520202) | 520202..520603 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP52_RS02670 (520615) | 520615..521622 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP52_RS02675 (521684) | 521684..522013 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP52_RS02680 (522010) | 522010..522492 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP52_RS02685 (522458) | 522458..523246 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP52_RS02690 (523246) | 523246..523845 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296888 WP_003156187.1 NZ_OX419575:518539-518889 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|