Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1369514..1370430 | Replicon | chromosome |
Accession | NZ_OX419573 | ||
Organism | Bacillus subtilis isolate NRS6085 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP57_RS07285 | Protein ID | WP_003244695.1 |
Coordinates | 1369684..1370430 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP57_RS07280 | Protein ID | WP_003232646.1 |
Coordinates | 1369514..1369684 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP57_RS07245 (1366380) | 1366380..1366706 | + | 327 | WP_124059766.1 | XkdW family protein | - |
KJP57_RS07250 (1366703) | 1366703..1366867 | + | 165 | WP_014479563.1 | XkdX family protein | - |
KJP57_RS07255 (1366911) | 1366911..1367750 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
KJP57_RS07260 (1367803) | 1367803..1368072 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP57_RS07265 (1368085) | 1368085..1368348 | + | 264 | WP_003232653.1 | phage holin | - |
KJP57_RS07270 (1368361) | 1368361..1369254 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP57_RS07275 (1369291) | 1369291..1369428 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP57_RS07280 (1369514) | 1369514..1369684 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP57_RS07285 (1369684) | 1369684..1370430 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP57_RS07290 (1370540) | 1370540..1371541 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP57_RS07295 (1371554) | 1371554..1372171 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP57_RS07300 (1372447) | 1372447..1373763 | - | 1317 | WP_128740275.1 | serine/threonine exchanger | - |
KJP57_RS07305 (1374152) | 1374152..1375102 | + | 951 | WP_015252261.1 | ring-cleaving dioxygenase | - |
KJP57_RS07310 (1375203) | 1375203..1375349 | + | 147 | WP_122894618.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296874 WP_003244695.1 NZ_OX419573:c1370430-1369684 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|