Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 571179..571815 | Replicon | chromosome |
Accession | NZ_OX419573 | ||
Organism | Bacillus subtilis isolate NRS6085 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP57_RS03035 | Protein ID | WP_003156187.1 |
Coordinates | 571465..571815 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP57_RS03030 | Protein ID | WP_003225183.1 |
Coordinates | 571179..571460 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP57_RS03010 (567538) | 567538..568137 | - | 600 | WP_029317326.1 | rhomboid family intramembrane serine protease | - |
KJP57_RS03015 (568232) | 568232..568597 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
KJP57_RS03020 (568763) | 568763..569779 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP57_RS03025 (569894) | 569894..571063 | + | 1170 | WP_017697002.1 | alanine racemase | - |
KJP57_RS03030 (571179) | 571179..571460 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP57_RS03035 (571465) | 571465..571815 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP57_RS03040 (571930) | 571930..572754 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP57_RS03045 (572759) | 572759..573124 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP57_RS03050 (573128) | 573128..573529 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP57_RS03055 (573541) | 573541..574548 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP57_RS03060 (574610) | 574610..574939 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP57_RS03065 (574936) | 574936..575418 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP57_RS03070 (575384) | 575384..576172 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP57_RS03075 (576172) | 576172..576771 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296873 WP_003156187.1 NZ_OX419573:571465-571815 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|