Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1384796..1385712 | Replicon | chromosome |
| Accession | NZ_OX419570 | ||
| Organism | Bacillus subtilis isolate NRS6134 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | KJP59_RS07360 | Protein ID | WP_003244695.1 |
| Coordinates | 1384966..1385712 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | KJP59_RS07355 | Protein ID | WP_003232646.1 |
| Coordinates | 1384796..1384966 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP59_RS07320 (1381659) | 1381659..1381988 | + | 330 | WP_003232660.1 | XkdW family protein | - |
| KJP59_RS07325 (1381985) | 1381985..1382149 | + | 165 | WP_003232658.1 | XkdX family protein | - |
| KJP59_RS07330 (1382193) | 1382193..1383032 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
| KJP59_RS07335 (1383085) | 1383085..1383354 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| KJP59_RS07340 (1383367) | 1383367..1383630 | + | 264 | WP_003232653.1 | phage holin | - |
| KJP59_RS07345 (1383643) | 1383643..1384536 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KJP59_RS07350 (1384573) | 1384573..1384710 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| KJP59_RS07355 (1384796) | 1384796..1384966 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| KJP59_RS07360 (1384966) | 1384966..1385712 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| KJP59_RS07365 (1385822) | 1385822..1386823 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| KJP59_RS07370 (1386836) | 1386836..1387453 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| KJP59_RS07375 (1387729) | 1387729..1389045 | - | 1317 | WP_063695059.1 | serine/threonine exchanger | - |
| KJP59_RS07380 (1389434) | 1389434..1390384 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| KJP59_RS07385 (1390485) | 1390485..1390631 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296866 WP_003244695.1 NZ_OX419570:c1385712-1384966 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|