Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 573431..574067 | Replicon | chromosome |
Accession | NZ_OX419570 | ||
Organism | Bacillus subtilis isolate NRS6134 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP59_RS03030 | Protein ID | WP_003156187.1 |
Coordinates | 573717..574067 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP59_RS03025 | Protein ID | WP_003225183.1 |
Coordinates | 573431..573712 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP59_RS03005 (569790) | 569790..570389 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP59_RS03010 (570484) | 570484..570849 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
KJP59_RS03015 (571015) | 571015..572031 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP59_RS03020 (572146) | 572146..573315 | + | 1170 | WP_003234284.1 | alanine racemase | - |
KJP59_RS03025 (573431) | 573431..573712 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP59_RS03030 (573717) | 573717..574067 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP59_RS03035 (574182) | 574182..575006 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP59_RS03040 (575011) | 575011..575376 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP59_RS03045 (575380) | 575380..575781 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP59_RS03050 (575793) | 575793..576800 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP59_RS03055 (576862) | 576862..577191 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP59_RS03060 (577188) | 577188..577670 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP59_RS03065 (577636) | 577636..578424 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP59_RS03070 (578424) | 578424..579023 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296865 WP_003156187.1 NZ_OX419570:573717-574067 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|