Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1348027..1348943 | Replicon | chromosome |
Accession | NZ_OX419569 | ||
Organism | Bacillus subtilis isolate NRS6118 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP55_RS07100 | Protein ID | WP_003244695.1 |
Coordinates | 1348197..1348943 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP55_RS07095 | Protein ID | WP_003232646.1 |
Coordinates | 1348027..1348197 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP55_RS07060 (1344890) | 1344890..1345219 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP55_RS07065 (1345216) | 1345216..1345380 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP55_RS07070 (1345424) | 1345424..1346263 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP55_RS07075 (1346316) | 1346316..1346585 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP55_RS07080 (1346598) | 1346598..1346861 | + | 264 | WP_003232653.1 | phage holin | - |
KJP55_RS07085 (1346874) | 1346874..1347767 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP55_RS07090 (1347804) | 1347804..1347941 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP55_RS07095 (1348027) | 1348027..1348197 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP55_RS07100 (1348197) | 1348197..1348943 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP55_RS07105 (1349053) | 1349053..1350054 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP55_RS07110 (1350067) | 1350067..1350684 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP55_RS07115 (1350960) | 1350960..1352276 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP55_RS07120 (1352665) | 1352665..1353615 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP55_RS07125 (1353716) | 1353716..1353862 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296845 WP_003244695.1 NZ_OX419569:c1348943-1348197 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|