Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1327529..1328445 | Replicon | chromosome |
Accession | NZ_OX419567 | ||
Organism | Bacillus subtilis isolate NRS6107 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP42_RS06960 | Protein ID | WP_003244695.1 |
Coordinates | 1327699..1328445 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP42_RS06955 | Protein ID | WP_003232646.1 |
Coordinates | 1327529..1327699 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP42_RS06920 (1324392) | 1324392..1324721 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP42_RS06925 (1324718) | 1324718..1324882 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP42_RS06930 (1324926) | 1324926..1325765 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP42_RS06935 (1325818) | 1325818..1326087 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP42_RS06940 (1326100) | 1326100..1326363 | + | 264 | WP_003232653.1 | phage holin | - |
KJP42_RS06945 (1326376) | 1326376..1327269 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP42_RS06950 (1327306) | 1327306..1327443 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP42_RS06955 (1327529) | 1327529..1327699 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP42_RS06960 (1327699) | 1327699..1328445 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP42_RS06965 (1328555) | 1328555..1329556 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP42_RS06970 (1329569) | 1329569..1330186 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP42_RS06975 (1330462) | 1330462..1331778 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP42_RS06980 (1332167) | 1332167..1333117 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP42_RS06985 (1333218) | 1333218..1333364 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296837 WP_003244695.1 NZ_OX419567:c1328445-1327699 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|