Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1319780..1320696 | Replicon | chromosome |
Accession | NZ_OX419565 | ||
Organism | Bacillus subtilis isolate NRS6145 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP64_RS06940 | Protein ID | WP_003244695.1 |
Coordinates | 1319950..1320696 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP64_RS06935 | Protein ID | WP_003232646.1 |
Coordinates | 1319780..1319950 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP64_RS06900 (NRS6145_06815) | 1316643..1316972 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP64_RS06905 (NRS6145_06820) | 1316969..1317133 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP64_RS06910 (NRS6145_06825) | 1317177..1318016 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP64_RS06915 (NRS6145_06830) | 1318069..1318338 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP64_RS06920 (NRS6145_06835) | 1318351..1318614 | + | 264 | WP_003232653.1 | phage holin | - |
KJP64_RS06925 (NRS6145_06840) | 1318627..1319520 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP64_RS06930 | 1319557..1319694 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP64_RS06935 (NRS6145_06845) | 1319780..1319950 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP64_RS06940 (NRS6145_06850) | 1319950..1320696 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP64_RS06945 (NRS6145_06855) | 1320806..1321807 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP64_RS06950 (NRS6145_06860) | 1321820..1322437 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP64_RS06955 (NRS6145_06865) | 1322713..1324029 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP64_RS06960 (NRS6145_06870) | 1324418..1325368 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP64_RS06965 | 1325477..1325572 | + | 96 | Protein_1311 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296833 WP_003244695.1 NZ_OX419565:c1320696-1319950 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|