Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 512225..512861 | Replicon | chromosome |
Accession | NZ_OX419565 | ||
Organism | Bacillus subtilis isolate NRS6145 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP64_RS02625 | Protein ID | WP_003156187.1 |
Coordinates | 512511..512861 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP64_RS02620 | Protein ID | WP_003225183.1 |
Coordinates | 512225..512506 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP64_RS02600 (NRS6145_02580) | 508584..509183 | - | 600 | WP_032722928.1 | rhomboid family intramembrane serine protease | - |
KJP64_RS02605 (NRS6145_02585) | 509278..509643 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
KJP64_RS02610 (NRS6145_02590) | 509809..510825 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP64_RS02615 (NRS6145_02595) | 510940..512109 | + | 1170 | WP_032722929.1 | alanine racemase | - |
KJP64_RS02620 (NRS6145_02600) | 512225..512506 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP64_RS02625 (NRS6145_02605) | 512511..512861 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP64_RS02630 (NRS6145_02610) | 512977..513801 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP64_RS02635 (NRS6145_02615) | 513806..514171 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP64_RS02640 (NRS6145_02620) | 514175..514576 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP64_RS02645 (NRS6145_02625) | 514588..515595 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP64_RS02650 (NRS6145_02630) | 515657..515986 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP64_RS02655 (NRS6145_02635) | 515983..516465 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP64_RS02660 (NRS6145_02640) | 516431..517219 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP64_RS02665 (NRS6145_02645) | 517219..517818 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296832 WP_003156187.1 NZ_OX419565:512511-512861 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|