Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1320224..1321140 | Replicon | chromosome |
| Accession | NZ_OX419564 | ||
| Organism | Bacillus subtilis isolate NRS6127 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | KJP48_RS06940 | Protein ID | WP_003244695.1 |
| Coordinates | 1320394..1321140 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | KJP48_RS06935 | Protein ID | WP_003232646.1 |
| Coordinates | 1320224..1320394 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP48_RS06900 (1317090) | 1317090..1317416 | + | 327 | WP_029727046.1 | XkdW family protein | - |
| KJP48_RS06905 (1317413) | 1317413..1317577 | + | 165 | WP_014479563.1 | XkdX family protein | - |
| KJP48_RS06910 (1317621) | 1317621..1318460 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
| KJP48_RS06915 (1318513) | 1318513..1318782 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
| KJP48_RS06920 (1318795) | 1318795..1319058 | + | 264 | WP_014479566.1 | phage holin | - |
| KJP48_RS06925 (1319071) | 1319071..1319964 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KJP48_RS06930 (1320001) | 1320001..1320138 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| KJP48_RS06935 (1320224) | 1320224..1320394 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| KJP48_RS06940 (1320394) | 1320394..1321140 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| KJP48_RS06945 (1321250) | 1321250..1322251 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| KJP48_RS06950 (1322264) | 1322264..1322881 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| KJP48_RS06955 (1323157) | 1323157..1324473 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
| KJP48_RS06960 (1324861) | 1324861..1325811 | + | 951 | WP_003232637.1 | VOC family protein | - |
| KJP48_RS06965 (1325920) | 1325920..1326015 | + | 96 | Protein_1308 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296818 WP_003244695.1 NZ_OX419564:c1321140-1320394 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|