Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 516721..517357 | Replicon | chromosome |
Accession | NZ_OX419564 | ||
Organism | Bacillus subtilis isolate NRS6127 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP48_RS02635 | Protein ID | WP_003156187.1 |
Coordinates | 517007..517357 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP48_RS02630 | Protein ID | WP_003225183.1 |
Coordinates | 516721..517002 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP48_RS02610 (513081) | 513081..513680 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP48_RS02615 (513775) | 513775..514140 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
KJP48_RS02620 (514306) | 514306..515322 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP48_RS02625 (515436) | 515436..516605 | + | 1170 | WP_029727188.1 | alanine racemase | - |
KJP48_RS02630 (516721) | 516721..517002 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP48_RS02635 (517007) | 517007..517357 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP48_RS02640 (517472) | 517472..518296 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP48_RS02645 (518301) | 518301..518666 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
KJP48_RS02650 (518670) | 518670..519071 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP48_RS02655 (519083) | 519083..520090 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP48_RS02660 (520152) | 520152..520481 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP48_RS02665 (520478) | 520478..520960 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP48_RS02670 (520926) | 520926..521714 | + | 789 | WP_029727187.1 | RNA polymerase sigma factor SigB | - |
KJP48_RS02675 (521714) | 521714..522313 | + | 600 | WP_003234303.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296817 WP_003156187.1 NZ_OX419564:517007-517357 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|