Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1402769..1403685 | Replicon | chromosome |
Accession | NZ_OX419563 | ||
Organism | Bacillus subtilis isolate NRS6153 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP66_RS07485 | Protein ID | WP_003244695.1 |
Coordinates | 1402939..1403685 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP66_RS07480 | Protein ID | WP_003232646.1 |
Coordinates | 1402769..1402939 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP66_RS07445 (1399632) | 1399632..1399961 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP66_RS07450 (1399958) | 1399958..1400122 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP66_RS07455 (1400166) | 1400166..1401005 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP66_RS07460 (1401058) | 1401058..1401327 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP66_RS07465 (1401340) | 1401340..1401603 | + | 264 | WP_003232653.1 | phage holin | - |
KJP66_RS07470 (1401616) | 1401616..1402509 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP66_RS07475 (1402546) | 1402546..1402683 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP66_RS07480 (1402769) | 1402769..1402939 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP66_RS07485 (1402939) | 1402939..1403685 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP66_RS07490 (1403795) | 1403795..1404796 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP66_RS07495 (1404809) | 1404809..1405426 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP66_RS07500 (1405702) | 1405702..1407018 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP66_RS07505 (1407407) | 1407407..1408357 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP66_RS07510 (1408458) | 1408458..1408604 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296810 WP_003244695.1 NZ_OX419563:c1403685-1402939 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|