Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 570893..571529 | Replicon | chromosome |
| Accession | NZ_OX419563 | ||
| Organism | Bacillus subtilis isolate NRS6153 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | KJP66_RS03010 | Protein ID | WP_003156187.1 |
| Coordinates | 571179..571529 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | KJP66_RS03005 | Protein ID | WP_003225183.1 |
| Coordinates | 570893..571174 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP66_RS02985 (567252) | 567252..567851 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
| KJP66_RS02990 (567946) | 567946..568311 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
| KJP66_RS02995 (568477) | 568477..569493 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| KJP66_RS03000 (569608) | 569608..570777 | + | 1170 | WP_003234284.1 | alanine racemase | - |
| KJP66_RS03005 (570893) | 570893..571174 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| KJP66_RS03010 (571179) | 571179..571529 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| KJP66_RS03015 (571644) | 571644..572468 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| KJP66_RS03020 (572473) | 572473..572838 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| KJP66_RS03025 (572842) | 572842..573243 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
| KJP66_RS03030 (573255) | 573255..574262 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| KJP66_RS03035 (574324) | 574324..574653 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| KJP66_RS03040 (574650) | 574650..575132 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| KJP66_RS03045 (575098) | 575098..575886 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| KJP66_RS03050 (575886) | 575886..576485 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296809 WP_003156187.1 NZ_OX419563:571179-571529 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|