Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1330123..1331039 | Replicon | chromosome |
Accession | NZ_OX419560 | ||
Organism | Bacillus subtilis isolate NRS6132 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP75_RS06985 | Protein ID | WP_003244695.1 |
Coordinates | 1330293..1331039 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP75_RS06980 | Protein ID | WP_003232646.1 |
Coordinates | 1330123..1330293 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP75_RS06945 (NRS6132_06865) | 1326989..1327315 | + | 327 | WP_069703538.1 | XkdW family protein | - |
KJP75_RS06950 (NRS6132_06870) | 1327312..1327476 | + | 165 | WP_014479563.1 | XkdX family protein | - |
KJP75_RS06955 (NRS6132_06875) | 1327520..1328359 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
KJP75_RS06960 (NRS6132_06880) | 1328412..1328681 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
KJP75_RS06965 (NRS6132_06885) | 1328694..1328957 | + | 264 | WP_014479566.1 | phage holin | - |
KJP75_RS06970 (NRS6132_06890) | 1328970..1329863 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP75_RS06975 | 1329900..1330037 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP75_RS06980 (NRS6132_06895) | 1330123..1330293 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP75_RS06985 (NRS6132_06900) | 1330293..1331039 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP75_RS06990 (NRS6132_06905) | 1331149..1332150 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP75_RS06995 (NRS6132_06910) | 1332163..1332780 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP75_RS07000 (NRS6132_06915) | 1333056..1334372 | - | 1317 | WP_029317680.1 | serine/threonine exchanger | - |
KJP75_RS07005 (NRS6132_06920) | 1334761..1335711 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
KJP75_RS07010 | 1335820..1335915 | + | 96 | Protein_1317 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296808 WP_003244695.1 NZ_OX419560:c1331039-1330293 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|