Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 517828..518464 | Replicon | chromosome |
| Accession | NZ_OX419560 | ||
| Organism | Bacillus subtilis isolate NRS6132 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | KJP75_RS02645 | Protein ID | WP_003156187.1 |
| Coordinates | 518114..518464 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | KJP75_RS02640 | Protein ID | WP_003225183.1 |
| Coordinates | 517828..518109 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP75_RS02620 (NRS6132_02575) | 514187..514786 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
| KJP75_RS02625 (NRS6132_02580) | 514881..515246 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
| KJP75_RS02630 (NRS6132_02585) | 515412..516428 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| KJP75_RS02635 (NRS6132_02590) | 516543..517712 | + | 1170 | WP_003234284.1 | alanine racemase | - |
| KJP75_RS02640 (NRS6132_02595) | 517828..518109 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| KJP75_RS02645 (NRS6132_02600) | 518114..518464 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| KJP75_RS02650 (NRS6132_02605) | 518579..519403 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| KJP75_RS02655 (NRS6132_02610) | 519408..519773 | + | 366 | WP_015715277.1 | RsbT antagonist protein RsbS | - |
| KJP75_RS02660 (NRS6132_02615) | 519777..520178 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
| KJP75_RS02665 (NRS6132_02620) | 520190..521197 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| KJP75_RS02670 (NRS6132_02625) | 521259..521588 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| KJP75_RS02675 (NRS6132_02630) | 521585..522067 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| KJP75_RS02680 (NRS6132_02635) | 522033..522821 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| KJP75_RS02685 (NRS6132_02640) | 522821..523420 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296807 WP_003156187.1 NZ_OX419560:518114-518464 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|