Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1361959..1362875 | Replicon | chromosome |
Accession | NZ_OX419555 | ||
Organism | Bacillus subtilis isolate NRS6181 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP65_RS07255 | Protein ID | WP_003244695.1 |
Coordinates | 1362129..1362875 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP65_RS07250 | Protein ID | WP_003232646.1 |
Coordinates | 1361959..1362129 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP65_RS07215 (NRS6181_07185) | 1358825..1359151 | + | 327 | WP_069703538.1 | XkdW family protein | - |
KJP65_RS07220 (NRS6181_07190) | 1359148..1359312 | + | 165 | WP_014479563.1 | XkdX family protein | - |
KJP65_RS07225 (NRS6181_07195) | 1359356..1360195 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
KJP65_RS07230 (NRS6181_07200) | 1360248..1360517 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
KJP65_RS07235 (NRS6181_07205) | 1360530..1360793 | + | 264 | WP_014479566.1 | phage holin | - |
KJP65_RS07240 (NRS6181_07210) | 1360806..1361699 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP65_RS07245 (NRS6181_07215) | 1361736..1361873 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP65_RS07250 (NRS6181_07220) | 1361959..1362129 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP65_RS07255 (NRS6181_07225) | 1362129..1362875 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP65_RS07260 (NRS6181_07230) | 1362985..1363986 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP65_RS07265 (NRS6181_07235) | 1363999..1364616 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP65_RS07270 (NRS6181_07240) | 1364892..1366208 | - | 1317 | WP_029317680.1 | serine/threonine exchanger | - |
KJP65_RS07275 (NRS6181_07245) | 1366597..1367547 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
KJP65_RS07280 | 1367656..1367751 | + | 96 | Protein_1371 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1326400..1371257 | 44857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296789 WP_003244695.1 NZ_OX419555:c1362875-1362129 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|