Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1358351..1359267 | Replicon | chromosome |
Accession | NZ_OX419554 | ||
Organism | Bacillus subtilis isolate NRS6160 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP77_RS07225 | Protein ID | WP_003244695.1 |
Coordinates | 1358521..1359267 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP77_RS07220 | Protein ID | WP_003232646.1 |
Coordinates | 1358351..1358521 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP77_RS07185 (1355213) | 1355213..1355542 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP77_RS07190 (1355539) | 1355539..1355703 | + | 165 | WP_015715740.1 | XkdX family protein | - |
KJP77_RS07195 (1355747) | 1355747..1356586 | + | 840 | WP_088467634.1 | phage-like element PBSX protein XepA | - |
KJP77_RS07200 (1356639) | 1356639..1356908 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
KJP77_RS07205 (1356921) | 1356921..1357184 | + | 264 | WP_014479566.1 | phage holin | - |
KJP77_RS07210 (1357197) | 1357197..1358090 | + | 894 | WP_195727878.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP77_RS07215 (1358128) | 1358128..1358265 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP77_RS07220 (1358351) | 1358351..1358521 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP77_RS07225 (1358521) | 1358521..1359267 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP77_RS07230 (1359377) | 1359377..1360378 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
KJP77_RS07235 (1360391) | 1360391..1361008 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP77_RS07240 (1361284) | 1361284..1362600 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
KJP77_RS07245 (1362989) | 1362989..1363939 | + | 951 | WP_015715745.1 | ring-cleaving dioxygenase | - |
KJP77_RS07250 (1364048) | 1364048..1364143 | + | 96 | Protein_1365 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296778 WP_003244695.1 NZ_OX419554:c1359267-1358521 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|