Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 565930..566566 | Replicon | chromosome |
Accession | NZ_OX419554 | ||
Organism | Bacillus subtilis isolate NRS6160 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | KJP77_RS02990 | Protein ID | WP_003156187.1 |
Coordinates | 566216..566566 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | KJP77_RS02985 | Protein ID | WP_003225183.1 |
Coordinates | 565930..566211 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP77_RS02965 (562289) | 562289..562888 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
KJP77_RS02970 (562983) | 562983..563348 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
KJP77_RS02975 (563514) | 563514..564530 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
KJP77_RS02980 (564645) | 564645..565814 | + | 1170 | WP_003234284.1 | alanine racemase | - |
KJP77_RS02985 (565930) | 565930..566211 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
KJP77_RS02990 (566216) | 566216..566566 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KJP77_RS02995 (566681) | 566681..567505 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
KJP77_RS03000 (567510) | 567510..567875 | + | 366 | WP_015715277.1 | RsbT antagonist protein RsbS | - |
KJP77_RS03005 (567879) | 567879..568280 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
KJP77_RS03010 (568292) | 568292..569299 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
KJP77_RS03015 (569361) | 569361..569690 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
KJP77_RS03020 (569687) | 569687..570169 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
KJP77_RS03025 (570135) | 570135..570923 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
KJP77_RS03030 (570923) | 570923..571522 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T296777 WP_003156187.1 NZ_OX419554:566216-566566 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|