Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1322966..1323882 | Replicon | chromosome |
| Accession | NZ_OX419553 | ||
| Organism | Bacillus subtilis isolate NRS6183 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | KJP78_RS06955 | Protein ID | WP_003244695.1 |
| Coordinates | 1323136..1323882 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | KJP78_RS06950 | Protein ID | WP_003232646.1 |
| Coordinates | 1322966..1323136 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP78_RS06915 (1319832) | 1319832..1320158 | + | 327 | WP_029727046.1 | XkdW family protein | - |
| KJP78_RS06920 (1320155) | 1320155..1320319 | + | 165 | WP_014479563.1 | XkdX family protein | - |
| KJP78_RS06925 (1320363) | 1320363..1321202 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
| KJP78_RS06930 (1321255) | 1321255..1321524 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
| KJP78_RS06935 (1321537) | 1321537..1321800 | + | 264 | WP_014479566.1 | phage holin | - |
| KJP78_RS06940 (1321813) | 1321813..1322706 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KJP78_RS06945 (1322743) | 1322743..1322880 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| KJP78_RS06950 (1322966) | 1322966..1323136 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| KJP78_RS06955 (1323136) | 1323136..1323882 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| KJP78_RS06960 (1323992) | 1323992..1324993 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
| KJP78_RS06965 (1325006) | 1325006..1325623 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| KJP78_RS06970 (1325899) | 1325899..1327215 | - | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
| KJP78_RS06975 (1327604) | 1327604..1328554 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| KJP78_RS06980 (1328663) | 1328663..1328758 | + | 96 | Protein_1311 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296763 WP_003244695.1 NZ_OX419553:c1323882-1323136 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|