Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1329642..1330558 | Replicon | chromosome |
Accession | NZ_OX419551 | ||
Organism | Bacillus subtilis isolate NRS6190 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | KJP53_RS06970 | Protein ID | WP_003244695.1 |
Coordinates | 1329812..1330558 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | KJP53_RS06965 | Protein ID | WP_003232646.1 |
Coordinates | 1329642..1329812 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP53_RS06930 (1326505) | 1326505..1326834 | + | 330 | WP_003232660.1 | XkdW family protein | - |
KJP53_RS06935 (1326831) | 1326831..1326995 | + | 165 | WP_003232658.1 | XkdX family protein | - |
KJP53_RS06940 (1327039) | 1327039..1327878 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
KJP53_RS06945 (1327931) | 1327931..1328200 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
KJP53_RS06950 (1328213) | 1328213..1328476 | + | 264 | WP_003232653.1 | phage holin | - |
KJP53_RS06955 (1328489) | 1328489..1329382 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
KJP53_RS06960 (1329419) | 1329419..1329556 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
KJP53_RS06965 (1329642) | 1329642..1329812 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
KJP53_RS06970 (1329812) | 1329812..1330558 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
KJP53_RS06975 (1330668) | 1330668..1331669 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
KJP53_RS06980 (1331682) | 1331682..1332299 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
KJP53_RS06985 (1332575) | 1332575..1333891 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
KJP53_RS06990 (1334280) | 1334280..1335230 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
KJP53_RS06995 (1335331) | 1335331..1335477 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296755 WP_003244695.1 NZ_OX419551:c1330558-1329812 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|