Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1330124..1331040 | Replicon | chromosome |
| Accession | NZ_OX419550 | ||
| Organism | Bacillus subtilis isolate NRS6187 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | KJP69_RS06980 | Protein ID | WP_003244695.1 |
| Coordinates | 1330294..1331040 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | KJP69_RS06975 | Protein ID | WP_003232646.1 |
| Coordinates | 1330124..1330294 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP69_RS06940 (NRS6187_06865) | 1326990..1327316 | + | 327 | WP_069703538.1 | XkdW family protein | - |
| KJP69_RS06945 (NRS6187_06870) | 1327313..1327477 | + | 165 | WP_014479563.1 | XkdX family protein | - |
| KJP69_RS06950 (NRS6187_06875) | 1327521..1328360 | + | 840 | WP_029727045.1 | phage-like element PBSX protein XepA | - |
| KJP69_RS06955 (NRS6187_06880) | 1328413..1328682 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
| KJP69_RS06960 (NRS6187_06885) | 1328695..1328958 | + | 264 | WP_014479566.1 | phage holin | - |
| KJP69_RS06965 (NRS6187_06890) | 1328971..1329864 | + | 894 | WP_029727044.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KJP69_RS06970 | 1329901..1330038 | - | 138 | WP_119899277.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| KJP69_RS06975 (NRS6187_06895) | 1330124..1330294 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| KJP69_RS06980 (NRS6187_06900) | 1330294..1331040 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| KJP69_RS06985 (NRS6187_06905) | 1331150..1332151 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| KJP69_RS06990 (NRS6187_06910) | 1332164..1332781 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| KJP69_RS06995 (NRS6187_06915) | 1333057..1334373 | - | 1317 | WP_029317680.1 | serine/threonine exchanger | - |
| KJP69_RS07000 (NRS6187_06920) | 1334762..1335712 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
| KJP69_RS07005 | 1335821..1335916 | + | 96 | Protein_1316 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T296753 WP_003244695.1 NZ_OX419550:c1331040-1330294 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|