Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 3649826..3650383 | Replicon | chromosome |
| Accession | NZ_OX419519 | ||
| Organism | Kitasatospora sp. DSM 114396 isolate DSM_114396 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QMQ26_RS16860 | Protein ID | WP_282206222.1 |
| Coordinates | 3649826..3650107 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QMQ26_RS16865 | Protein ID | WP_282206542.1 |
| Coordinates | 3650114..3650383 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMQ26_RS16850 | 3646493..3648946 | + | 2454 | WP_282206220.1 | helicase C-terminal domain-containing protein | - |
| QMQ26_RS16855 | 3649201..3649608 | + | 408 | WP_282206221.1 | carboxymuconolactone decarboxylase family protein | - |
| QMQ26_RS16860 | 3649826..3650107 | - | 282 | WP_282206222.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMQ26_RS16865 | 3650114..3650383 | - | 270 | WP_282206542.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QMQ26_RS16870 | 3650474..3651148 | - | 675 | WP_282206223.1 | hypothetical protein | - |
| QMQ26_RS16875 | 3651257..3651892 | + | 636 | WP_282206224.1 | TetR/AcrR family transcriptional regulator | - |
| QMQ26_RS16880 | 3652213..3652434 | - | 222 | WP_100837429.1 | hypothetical protein | - |
| QMQ26_RS16885 | 3652884..3653087 | + | 204 | WP_030918248.1 | cold-shock protein | - |
| QMQ26_RS16890 | 3653403..3654812 | + | 1410 | WP_282206225.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10743.42 Da Isoelectric Point: 11.5385
>T296751 WP_282206222.1 NZ_OX419519:c3650107-3649826 [Kitasatospora sp. DSM 114396]
MGHVTRFTPRAQRDLLKIERSDALRILRRLADLQRAMDLGDTTAFDVKALQGHAARWRLRIGDHRAVYTVENGQLIIWVL
GVGHRSDIYRQLP
MGHVTRFTPRAQRDLLKIERSDALRILRRLADLQRAMDLGDTTAFDVKALQGHAARWRLRIGDHRAVYTVENGQLIIWVL
GVGHRSDIYRQLP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|