Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-RelB |
Location | 3639279..3639820 | Replicon | chromosome |
Accession | NZ_OX419519 | ||
Organism | Kitasatospora sp. DSM 114396 isolate DSM_114396 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QMQ26_RS16825 | Protein ID | WP_282206217.1 |
Coordinates | 3639554..3639820 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QMQ26_RS16820 | Protein ID | WP_199847013.1 |
Coordinates | 3639279..3639557 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMQ26_RS16790 | 3634607..3635206 | - | 600 | WP_100838613.1 | recombination mediator RecR | - |
QMQ26_RS16795 | 3635489..3635827 | - | 339 | WP_100837462.1 | YbaB/EbfC family nucleoid-associated protein | - |
QMQ26_RS16800 | 3636000..3638207 | - | 2208 | WP_282206215.1 | DNA polymerase III subunit gamma and tau | - |
QMQ26_RS16815 | 3638682..3639245 | + | 564 | WP_282206216.1 | SMI1/KNR4 family protein | - |
QMQ26_RS16820 | 3639279..3639557 | + | 279 | WP_199847013.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QMQ26_RS16825 | 3639554..3639820 | + | 267 | WP_282206217.1 | Txe/YoeB family addiction module toxin | Toxin |
QMQ26_RS16830 | 3640074..3642161 | + | 2088 | WP_282206218.1 | histidine kinase | - |
QMQ26_RS16835 | 3642183..3642791 | - | 609 | WP_100837437.1 | response regulator transcription factor | - |
QMQ26_RS16840 | 3642877..3643611 | + | 735 | WP_282206219.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10475.91 Da Isoelectric Point: 8.4927
>T296750 WP_282206217.1 NZ_OX419519:3639554-3639820 [Kitasatospora sp. DSM 114396]
VKIRFTDGGWADYLYWQANDRRLLKRINQLIEDIRRNGHEGIGKPEPLRHELAGAWSRRIDQEHRLVYVLDEPADTVCII
ACRYHYSK
VKIRFTDGGWADYLYWQANDRRLLKRINQLIEDIRRNGHEGIGKPEPLRHELAGAWSRRIDQEHRLVYVLDEPADTVCII
ACRYHYSK
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|