296748

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 2037577..2038105 Replicon chromosome
Accession NZ_OX411212
Organism Vibrio campbellii isolate BF5_0283

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag QMX76_RS10250 Protein ID WP_005377002.1
Coordinates 2037815..2038105 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag QMX76_RS10245 Protein ID WP_005377003.1
Coordinates 2037577..2037825 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMX76_RS10190 2032893..2033552 - 660 WP_050938677.1 restriction endonuclease -
QMX76_RS10195 2033582..2033671 - 90 WP_282250262.1 DUF3265 domain-containing protein -
QMX76_RS10200 2034193..2034285 - 93 WP_004748931.1 DUF3265 domain-containing protein -
QMX76_RS10205 2034300..2034893 - 594 WP_238803215.1 hypothetical protein -
QMX76_RS10210 2035099..2035191 - 93 WP_079771035.1 DUF3265 domain-containing protein -
QMX76_RS10215 2035236..2036180 - 945 WP_045602147.1 D-2-hydroxyacid dehydrogenase family protein -
QMX76_RS10220 2036210..2036350 - 141 Protein_1941 DUF3265 domain-containing protein -
QMX76_RS10225 2036328..2036612 - 285 WP_025640084.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
QMX76_RS10230 2036711..2036782 - 72 Protein_1943 DUF3265 domain-containing protein -
QMX76_RS10235 2036779..2037375 - 597 WP_282249289.1 hypothetical protein -
QMX76_RS10240 2037434..2037502 - 69 WP_074531725.1 DUF3265 domain-containing protein -
QMX76_RS10245 2037577..2037825 + 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QMX76_RS10250 2037815..2038105 + 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QMX76_RS10255 2038124..2038216 - 93 WP_282249290.1 DUF3265 domain-containing protein -
QMX76_RS10260 2038231..2038647 - 417 WP_282249291.1 GNAT family N-acetyltransferase -
QMX76_RS10265 2038784..2039497 - 714 WP_282249292.1 hypothetical protein -
QMX76_RS10270 2039534..2039626 - 93 WP_072935543.1 DUF3265 domain-containing protein -
QMX76_RS10275 2039641..2040357 - 717 WP_282249293.1 hypothetical protein -
QMX76_RS10280 2040600..2042134 + 1535 WP_282249080.1 IS3 family transposase -
QMX76_RS10285 2042179..2042268 - 90 WP_072829120.1 DUF3265 domain-containing protein -
QMX76_RS10290 2042790..2042921 - 132 WP_282249294.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1980022..2048688 68666
- inside Integron - - 1992543..2039497 46954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T296748 WP_005377002.1 NZ_OX411212:2037815-2038105 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT296748 WP_005377003.1 NZ_OX411212:2037577-2037825 [Vibrio campbellii]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR03

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References