Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1562766..1563325 Replicon chromosome
Accession NZ_OX411212
Organism Vibrio campbellii isolate BF5_0283

Toxin (Protein)


Gene name relE Uniprot ID A0A2K7SRU8
Locus tag QMX76_RS07835 Protein ID WP_017035198.1
Coordinates 1562766..1563044 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR21
Locus tag QMX76_RS07840 Protein ID WP_005398409.1
Coordinates 1563041..1563325 (-) Length 95 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMX76_RS07785 1558185..1558274 + 90 WP_241214388.1 DUF3265 domain-containing protein -
QMX76_RS07790 1558806..1558895 + 90 WP_072833118.1 DUF3265 domain-containing protein -
QMX76_RS07795 1558934..1559356 + 423 WP_029789813.1 hypothetical protein -
QMX76_RS07800 1559381..1559474 + 94 Protein_1458 DUF3265 domain-containing protein -
QMX76_RS07805 1559498..1560052 + 555 WP_282249048.1 hypothetical protein -
QMX76_RS07810 1560067..1560159 + 93 WP_079855263.1 DUF3265 domain-containing protein -
QMX76_RS07815 1560206..1560862 + 657 WP_282249049.1 hypothetical protein -
QMX76_RS07820 1560885..1560977 + 93 WP_197072420.1 DUF3265 domain-containing protein -
QMX76_RS07825 1561497..1561586 + 90 WP_073514058.1 DUF3265 domain-containing protein -
QMX76_RS07830 1562606..1562737 + 132 WP_282249050.1 DUF3265 domain-containing protein -
QMX76_RS07835 1562766..1563044 - 279 WP_017035198.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QMX76_RS07840 1563041..1563325 - 285 WP_005398409.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QMX76_RS07845 1563402..1563493 + 92 Protein_1467 DUF3265 domain-containing protein -
QMX76_RS07850 1563542..1563814 + 273 WP_004748935.1 hypothetical protein -
QMX76_RS07855 1563932..1564024 + 93 WP_004749071.1 DUF3265 domain-containing protein -
QMX76_RS07860 1564568..1564657 + 90 WP_193277770.1 DUF3265 domain-containing protein -
QMX76_RS07865 1564703..1565350 + 648 WP_282249051.1 glutathione S-transferase -
QMX76_RS07870 1565347..1565457 + 111 WP_072615040.1 DUF3265 domain-containing protein -
QMX76_RS07875 1566092..1566679 + 588 WP_282249052.1 hypothetical protein -
QMX76_RS07880 1566642..1566791 + 150 WP_282249053.1 DUF3265 domain-containing protein -
QMX76_RS07885 1567210..1567339 + 130 Protein_1475 DUF3265 domain-containing protein -
QMX76_RS07890 1567759..1568082 + 324 WP_155487390.1 hypothetical protein -
QMX76_RS07895 1568079..1568141 + 63 Protein_1477 DUF3265 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1456846..1591556 134710
- inside Integron - - 1455649..1585468 129819


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 93 a.a.        Molecular weight: 10905.60 Da        Isoelectric Point: 4.3430

>T296746 WP_017035198.1 NZ_OX411212:c1563044-1562766 [Vibrio campbellii]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWIEGDIIRVM
RVLHQKQKFPTD

Download         Length: 279 bp


Antitoxin


Download         Length: 95 a.a.        Molecular weight: 11069.40 Da        Isoelectric Point: 9.2167

>AT296746 WP_005398409.1 NZ_OX411212:c1563325-1563041 [Vibrio campbellii]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ

Download         Length: 285 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A2K7SRU8


Antitoxin

Source ID Structure
AlphaFold DB A0A347UR21

References