Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1535575..1536103 Replicon chromosome
Accession NZ_OX411212
Organism Vibrio campbellii isolate BF5_0283

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag QMX76_RS07540 Protein ID WP_005377002.1
Coordinates 1535575..1535865 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QMX76_RS07545 Protein ID WP_229631645.1
Coordinates 1535855..1536103 (-) Length 83 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMX76_RS07475 1530726..1530818 + 93 WP_193238457.1 DUF3265 domain-containing protein -
QMX76_RS07480 1531220..1531342 + 123 WP_282250222.1 DUF3265 domain-containing protein -
QMX76_RS07485 1531371..1532030 + 660 WP_282249026.1 hypothetical protein -
QMX76_RS07490 1532045..1532137 + 93 WP_282249027.1 DUF3265 domain-containing protein -
QMX76_RS07495 1532236..1532667 + 432 WP_045392990.1 GNAT family N-acetyltransferase -
QMX76_RS07500 1532963..1533661 + 699 WP_072606224.1 hypothetical protein -
QMX76_RS07505 1533685..1533777 + 93 WP_005377014.1 DUF3265 domain-containing protein -
QMX76_RS07510 1533808..1534329 + 522 WP_282249028.1 GNAT family N-acetyltransferase -
QMX76_RS07515 1534360..1534452 + 93 WP_080540751.1 DUF3265 domain-containing protein -
QMX76_RS07520 1534500..1534868 + 369 WP_069549244.1 hypothetical protein -
QMX76_RS07525 1534859..1534921 + 63 Protein_1403 DUF3265 domain-containing protein -
QMX76_RS07530 1535003..1535449 + 447 WP_282249029.1 hypothetical protein -
QMX76_RS07535 1535464..1535556 + 93 WP_079854231.1 DUF3265 domain-containing protein -
QMX76_RS07540 1535575..1535865 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QMX76_RS07545 1535855..1536103 - 249 WP_229631645.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QMX76_RS07550 1536178..1536246 + 69 WP_074531725.1 DUF3265 domain-containing protein -
QMX76_RS07555 1536300..1536533 + 234 WP_005377029.1 hypothetical protein -
QMX76_RS07560 1536603..1536692 + 90 WP_193222964.1 DUF3265 domain-containing protein -
QMX76_RS07565 1536726..1537907 + 1182 WP_282249030.1 hypothetical protein -
QMX76_RS07570 1537922..1538014 + 93 WP_080256992.1 DUF3265 domain-containing protein -
QMX76_RS07575 1538040..1539065 + 1026 WP_134837661.1 LD-carboxypeptidase -
QMX76_RS07580 1539191..1539874 + 684 WP_282249031.1 hypothetical protein -
QMX76_RS07585 1539871..1540095 + 225 WP_282249032.1 hypothetical protein -
QMX76_RS07590 1540110..1540202 + 93 WP_004402681.1 DUF3265 domain-containing protein -
QMX76_RS07595 1540231..1540917 + 687 WP_110416610.1 DUF4336 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1456846..1591556 134710
- inside Integron - - 1455649..1585468 129819


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T296745 WP_005377002.1 NZ_OX411212:c1535865-1535575 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp


Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9049.34 Da        Isoelectric Point: 3.9610

>AT296745 WP_229631645.1 NZ_OX411212:c1536103-1535855 [Vibrio campbellii]
MATRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A347UR03


Antitoxin

Source ID Structure

References