Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1535575..1536103 | Replicon | chromosome |
Accession | NZ_OX411212 | ||
Organism | Vibrio campbellii isolate BF5_0283 |
Toxin (Protein)
Gene name | relE | Uniprot ID | K5TRR0 |
Locus tag | QMX76_RS07540 | Protein ID | WP_005377002.1 |
Coordinates | 1535575..1535865 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QMX76_RS07545 | Protein ID | WP_229631645.1 |
Coordinates | 1535855..1536103 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMX76_RS07475 | 1530726..1530818 | + | 93 | WP_193238457.1 | DUF3265 domain-containing protein | - |
QMX76_RS07480 | 1531220..1531342 | + | 123 | WP_282250222.1 | DUF3265 domain-containing protein | - |
QMX76_RS07485 | 1531371..1532030 | + | 660 | WP_282249026.1 | hypothetical protein | - |
QMX76_RS07490 | 1532045..1532137 | + | 93 | WP_282249027.1 | DUF3265 domain-containing protein | - |
QMX76_RS07495 | 1532236..1532667 | + | 432 | WP_045392990.1 | GNAT family N-acetyltransferase | - |
QMX76_RS07500 | 1532963..1533661 | + | 699 | WP_072606224.1 | hypothetical protein | - |
QMX76_RS07505 | 1533685..1533777 | + | 93 | WP_005377014.1 | DUF3265 domain-containing protein | - |
QMX76_RS07510 | 1533808..1534329 | + | 522 | WP_282249028.1 | GNAT family N-acetyltransferase | - |
QMX76_RS07515 | 1534360..1534452 | + | 93 | WP_080540751.1 | DUF3265 domain-containing protein | - |
QMX76_RS07520 | 1534500..1534868 | + | 369 | WP_069549244.1 | hypothetical protein | - |
QMX76_RS07525 | 1534859..1534921 | + | 63 | Protein_1403 | DUF3265 domain-containing protein | - |
QMX76_RS07530 | 1535003..1535449 | + | 447 | WP_282249029.1 | hypothetical protein | - |
QMX76_RS07535 | 1535464..1535556 | + | 93 | WP_079854231.1 | DUF3265 domain-containing protein | - |
QMX76_RS07540 | 1535575..1535865 | - | 291 | WP_005377002.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMX76_RS07545 | 1535855..1536103 | - | 249 | WP_229631645.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QMX76_RS07550 | 1536178..1536246 | + | 69 | WP_074531725.1 | DUF3265 domain-containing protein | - |
QMX76_RS07555 | 1536300..1536533 | + | 234 | WP_005377029.1 | hypothetical protein | - |
QMX76_RS07560 | 1536603..1536692 | + | 90 | WP_193222964.1 | DUF3265 domain-containing protein | - |
QMX76_RS07565 | 1536726..1537907 | + | 1182 | WP_282249030.1 | hypothetical protein | - |
QMX76_RS07570 | 1537922..1538014 | + | 93 | WP_080256992.1 | DUF3265 domain-containing protein | - |
QMX76_RS07575 | 1538040..1539065 | + | 1026 | WP_134837661.1 | LD-carboxypeptidase | - |
QMX76_RS07580 | 1539191..1539874 | + | 684 | WP_282249031.1 | hypothetical protein | - |
QMX76_RS07585 | 1539871..1540095 | + | 225 | WP_282249032.1 | hypothetical protein | - |
QMX76_RS07590 | 1540110..1540202 | + | 93 | WP_004402681.1 | DUF3265 domain-containing protein | - |
QMX76_RS07595 | 1540231..1540917 | + | 687 | WP_110416610.1 | DUF4336 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1456846..1591556 | 134710 | |
- | inside | Integron | - | - | 1455649..1585468 | 129819 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11261.25 Da Isoelectric Point: 10.5932
>T296745 WP_005377002.1 NZ_OX411212:c1535865-1535575 [Vibrio campbellii]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|