Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1482563..1483091 | Replicon | chromosome |
| Accession | NZ_OX411212 | ||
| Organism | Vibrio campbellii isolate BF5_0283 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F7YRA6 |
| Locus tag | QMX76_RS06925 | Protein ID | WP_013868556.1 |
| Coordinates | 1482804..1483091 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A4Y8W958 |
| Locus tag | QMX76_RS06920 | Protein ID | WP_017038856.1 |
| Coordinates | 1482563..1482814 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMX76_RS06875 | 1478014..1478373 | - | 360 | WP_282250321.1 | hypothetical protein | - |
| QMX76_RS06880 | 1478502..1478591 | + | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06885 | 1478712..1478993 | - | 282 | WP_282248986.1 | hypothetical protein | - |
| QMX76_RS06890 | 1479308..1479613 | - | 306 | WP_282248987.1 | hypothetical protein | - |
| QMX76_RS06895 | 1479700..1479831 | + | 132 | WP_079402534.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06900 | 1479864..1480223 | - | 360 | WP_282250324.1 | hypothetical protein | - |
| QMX76_RS06905 | 1480352..1480441 | + | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06910 | 1480490..1481230 | + | 741 | WP_282248988.1 | abortive infection system antitoxin AbiGi family protein | - |
| QMX76_RS06915 | 1481251..1481343 | + | 93 | WP_282250189.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06920 | 1482563..1482814 | + | 252 | WP_017038856.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QMX76_RS06925 | 1482804..1483091 | + | 288 | WP_013868556.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMX76_RS06930 | 1483792..1484217 | + | 426 | WP_140284315.1 | hypothetical protein | - |
| QMX76_RS06935 | 1484379..1485116 | + | 738 | WP_282248989.1 | SDR family oxidoreductase | - |
| QMX76_RS06940 | 1485722..1485853 | + | 132 | WP_159657865.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06945 | 1486299..1486388 | + | 90 | WP_072609598.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06950 | 1486459..1486608 | - | 150 | WP_086459347.1 | hypothetical protein | - |
| QMX76_RS06955 | 1486754..1486846 | + | 93 | WP_079856562.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06960 | 1486896..1487366 | + | 471 | WP_282248990.1 | GNAT family N-acetyltransferase | - |
| QMX76_RS06965 | 1487396..1487488 | + | 93 | WP_196333609.1 | DUF3265 domain-containing protein | - |
| QMX76_RS06970 | 1487579..1487857 | + | 279 | WP_282248991.1 | hypothetical protein | - |
| QMX76_RS06975 | 1487875..1487964 | + | 90 | WP_072829115.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1456846..1591556 | 134710 | |
| - | inside | Integron | - | - | 1455649..1585468 | 129819 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11064.07 Da Isoelectric Point: 10.5506
>T296744 WP_013868556.1 NZ_OX411212:1482804-1483091 [Vibrio campbellii]
MTYKLKFLPAAKKEWSKLAPPIQSQFKKKLKERLENPHVPSSKLRGYDSVYKIKLRTAGYRLAYEVIDDEIVVYVLAIGK
RDKDAVYKKLASRFS
MTYKLKFLPAAKKEWSKLAPPIQSQFKKKLKERLENPHVPSSKLRGYDSVYKIKLRTAGYRLAYEVIDDEIVVYVLAIGK
RDKDAVYKKLASRFS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1E5BHG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Y8W958 |