Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2260315..2260895 | Replicon | chromosome |
Accession | NZ_OX365700 | ||
Organism | Nitrospira sp. DNF |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QWI75_RS10665 | Protein ID | WP_289268562.1 |
Coordinates | 2260315..2260656 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QWI75_RS10670 | Protein ID | WP_289268563.1 |
Coordinates | 2260653..2260895 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QWI75_RS10650 (DNFV4_02214) | 2255600..2257738 | + | 2139 | WP_289268559.1 | DUF5050 domain-containing protein | - |
QWI75_RS10655 (DNFV4_02215) | 2258165..2259034 | + | 870 | WP_289268560.1 | hypothetical protein | - |
QWI75_RS10660 (DNFV4_02216) | 2259146..2259844 | + | 699 | WP_289268561.1 | hypothetical protein | - |
QWI75_RS10665 (DNFV4_02217) | 2260315..2260656 | - | 342 | WP_289268562.1 | endoribonuclease MazF | Toxin |
QWI75_RS10670 (DNFV4_02218) | 2260653..2260895 | - | 243 | WP_289268563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QWI75_RS10685 (DNFV4_02222) | 2263166..2264017 | + | 852 | WP_289268565.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
QWI75_RS10690 (DNFV4_02223) | 2264034..2264534 | - | 501 | WP_289268566.1 | tRNA adenosine(34) deaminase TadA | - |
QWI75_RS10695 (DNFV4_02224) | 2264732..2265895 | - | 1164 | WP_289268567.1 | nucleotidyltransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12524.56 Da Isoelectric Point: 10.2966
>T296742 WP_289268562.1 NZ_OX365700:c2260656-2260315 [Nitrospira sp. DNF]
VKSRRPYVPDRGDIVWLQFSPQVGHEQAGHRPALVLSPASYNRRSGLMLCCPMTSQRKDYPFEVVIPGEPDQKSVVLADQ
VKSLDWKARKAVKKGTAPVGVIADTLSKLQTLL
VKSRRPYVPDRGDIVWLQFSPQVGHEQAGHRPALVLSPASYNRRSGLMLCCPMTSQRKDYPFEVVIPGEPDQKSVVLADQ
VKSLDWKARKAVKKGTAPVGVIADTLSKLQTLL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|