Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 37708..38444 Replicon plasmid p01
Accession NZ_OX359183
Organism Klebsiella pneumoniae strain KP34 isolate 2018-347802-001-01

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag OM989_RS26665 Protein ID WP_003026803.1
Coordinates 37962..38444 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag OM989_RS26660 Protein ID WP_003026799.1
Coordinates 37708..37974 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM989_RS26615 (KPNEU34_KP34_05157) 33770..34132 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
OM989_RS26620 (KPNEU34_KP34_05158) 34182..34532 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
OM989_RS26625 (KPNEU34_KP34_05159) 34890..35159 + 270 WP_004152102.1 hypothetical protein -
OM989_RS26630 (KPNEU34_KP34_05160) 35147..35722 + 576 WP_004152103.1 hypothetical protein -
OM989_RS26635 (KPNEU34_KP34_05161) 35753..36247 + 495 WP_004152104.1 DNA-binding protein -
OM989_RS26640 (KPNEU34_KP34_05162) 36291..36659 + 369 WP_004152105.1 hypothetical protein -
OM989_RS26645 (KPNEU34_KP34_05163) 36693..36896 + 204 WP_004152106.1 HHA domain-containing protein -
OM989_RS26650 (KPNEU34_KP34_05164) 36945..37202 + 258 WP_004152107.1 hypothetical protein -
OM989_RS26655 (KPNEU34_KP34_05165) 37278..37532 + 255 WP_004152108.1 hypothetical protein -
OM989_RS26660 (KPNEU34_KP34_05166) 37708..37974 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
OM989_RS26665 (KPNEU34_KP34_05167) 37962..38444 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
OM989_RS26670 (KPNEU34_KP34_05168) 38652..39998 + 1347 WP_077253535.1 ISNCY family transposase -
OM989_RS26675 (KPNEU34_KP34_05169) 40047..40442 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
OM989_RS26680 40590..41755 - 1166 Protein_47 IS3 family transposase -
OM989_RS26685 (KPNEU34_KP34_05172) 41932..42894 - 963 WP_004152113.1 zinc metalloprotease HtpX -
OM989_RS26690 (KPNEU34_KP34_05173) 42881..43369 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / aac(3)-IIa / tet(A) / qnrB1 - 1..139364 139364


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T296728 WP_003026803.1 NZ_OX359183:37962-38444 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT296728 WP_003026799.1 NZ_OX359183:37708-37974 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References