Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3770126..3770745 Replicon chromosome
Accession NZ_OX359182
Organism Klebsiella pneumoniae strain KP34 isolate 2018-347802-001-01

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OM989_RS18175 Protein ID WP_002892050.1
Coordinates 3770126..3770344 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OM989_RS18180 Protein ID WP_002892066.1
Coordinates 3770371..3770745 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM989_RS18140 (3766173) 3766173..3766436 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
OM989_RS18145 (3766436) 3766436..3766576 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OM989_RS18150 (3766573) 3766573..3767271 - 699 WP_032435564.1 GNAT family protein -
OM989_RS18155 (3767372) 3767372..3768823 + 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
OM989_RS18160 (3768798) 3768798..3769268 - 471 WP_002892026.1 YlaC family protein -
OM989_RS18165 (3769289) 3769289..3769429 + 141 WP_004147370.1 hypothetical protein -
OM989_RS18170 (3769401) 3769401..3769967 - 567 WP_002892030.1 maltose O-acetyltransferase -
OM989_RS18175 (3770126) 3770126..3770344 - 219 WP_002892050.1 HHA domain-containing protein Toxin
OM989_RS18180 (3770371) 3770371..3770745 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OM989_RS18185 (3771231) 3771231..3774377 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OM989_RS18190 (3774400) 3774400..3775593 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T296725 WP_002892050.1 NZ_OX359182:c3770344-3770126 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT296725 WP_002892066.1 NZ_OX359182:c3770745-3770371 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References