Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3005138..3005654 | Replicon | chromosome |
Accession | NZ_OX359182 | ||
Organism | Klebsiella pneumoniae strain KP34 isolate 2018-347802-001-01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OM989_RS14570 | Protein ID | WP_004178374.1 |
Coordinates | 3005370..3005654 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | OM989_RS14565 | Protein ID | WP_032434351.1 |
Coordinates | 3005138..3005380 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM989_RS14550 (3001167) | 3001167..3001907 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
OM989_RS14555 (3001973) | 3001973..3003127 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
OM989_RS14560 (3003150) | 3003150..3005060 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OM989_RS14565 (3005138) | 3005138..3005380 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OM989_RS14570 (3005370) | 3005370..3005654 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM989_RS14575 (3005658) | 3005658..3006122 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OM989_RS14580 (3006364) | 3006364..3008502 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OM989_RS14585 (3008859) | 3008859..3009602 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OM989_RS14590 (3009605) | 3009605..3009778 | - | 174 | WP_032414379.1 | hypothetical protein | - |
OM989_RS14595 (3009863) | 3009863..3010171 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T296722 WP_004178374.1 NZ_OX359182:3005370-3005654 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|