Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1486338..1486995 | Replicon | chromosome |
| Accession | NZ_OX359182 | ||
| Organism | Klebsiella pneumoniae strain KP34 isolate 2018-347802-001-01 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | OM989_RS07090 | Protein ID | WP_002916310.1 |
| Coordinates | 1486338..1486748 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | OM989_RS07095 | Protein ID | WP_002916312.1 |
| Coordinates | 1486729..1486995 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM989_RS07070 (1482338) | 1482338..1484071 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OM989_RS07075 (1484077) | 1484077..1484790 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OM989_RS07080 (1484813) | 1484813..1485709 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| OM989_RS07085 (1485810) | 1485810..1486331 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
| OM989_RS07090 (1486338) | 1486338..1486748 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| OM989_RS07095 (1486729) | 1486729..1486995 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| OM989_RS07100 (1487241) | 1487241..1488224 | + | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
| OM989_RS07105 (1488323) | 1488323..1488982 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
| OM989_RS07110 (1489146) | 1489146..1489457 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| OM989_RS07115 (1489507) | 1489507..1490235 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| OM989_RS07120 (1490354) | 1490354..1491787 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T296714 WP_002916310.1 NZ_OX359182:c1486748-1486338 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |