Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53671..54407 Replicon plasmid p01
Accession NZ_OX359176
Organism Klebsiella pneumoniae strain KP47 isolate 2018-047100-007-01

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag ONI05_RS26620 Protein ID WP_003026803.1
Coordinates 53925..54407 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag ONI05_RS26615 Protein ID WP_003026799.1
Coordinates 53671..53937 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONI05_RS26570 (KPNEU47_KP47_05152) 49733..50095 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
ONI05_RS26575 (KPNEU47_KP47_05153) 50145..50495 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
ONI05_RS26580 (KPNEU47_KP47_05154) 50853..51122 + 270 WP_004152102.1 hypothetical protein -
ONI05_RS26585 (KPNEU47_KP47_05155) 51110..51685 + 576 WP_004152103.1 hypothetical protein -
ONI05_RS26590 (KPNEU47_KP47_05156) 51716..52210 + 495 WP_004152104.1 DNA-binding protein -
ONI05_RS26595 (KPNEU47_KP47_05157) 52254..52622 + 369 WP_004152105.1 hypothetical protein -
ONI05_RS26600 (KPNEU47_KP47_05158) 52656..52859 + 204 WP_004152106.1 HHA domain-containing protein -
ONI05_RS26605 (KPNEU47_KP47_05159) 52908..53165 + 258 WP_004152107.1 hypothetical protein -
ONI05_RS26610 (KPNEU47_KP47_05160) 53241..53495 + 255 WP_004152108.1 hypothetical protein -
ONI05_RS26615 (KPNEU47_KP47_05161) 53671..53937 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
ONI05_RS26620 (KPNEU47_KP47_05162) 53925..54407 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
ONI05_RS26625 (KPNEU47_KP47_05163) 54615..55961 + 1347 WP_077253535.1 ISNCY family transposase -
ONI05_RS26630 (KPNEU47_KP47_05164) 56010..56405 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
ONI05_RS26635 56553..57718 - 1166 Protein_59 IS3 family transposase -
ONI05_RS26640 (KPNEU47_KP47_05167) 57895..58857 - 963 WP_004152113.1 zinc metalloprotease HtpX -
ONI05_RS26645 (KPNEU47_KP47_05168) 58844..59332 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / qnrB1 - 1..141822 141822


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T296709 WP_003026803.1 NZ_OX359176:53925-54407 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT296709 WP_003026799.1 NZ_OX359176:53671-53937 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References