Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4849505..4850021 | Replicon | chromosome |
| Accession | NZ_OX359175 | ||
| Organism | Klebsiella pneumoniae strain KP47 isolate 2018-047100-007-01 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | ONI05_RS23440 | Protein ID | WP_004178374.1 |
| Coordinates | 4849505..4849789 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | ONI05_RS23445 | Protein ID | WP_032434351.1 |
| Coordinates | 4849779..4850021 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONI05_RS23415 (4844988) | 4844988..4845251 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| ONI05_RS23420 (4845381) | 4845381..4845554 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| ONI05_RS23425 (4845557) | 4845557..4846300 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| ONI05_RS23430 (4846657) | 4846657..4848795 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| ONI05_RS23435 (4849037) | 4849037..4849501 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| ONI05_RS23440 (4849505) | 4849505..4849789 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONI05_RS23445 (4849779) | 4849779..4850021 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| ONI05_RS23450 (4850099) | 4850099..4852009 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| ONI05_RS23455 (4852032) | 4852032..4853186 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| ONI05_RS23460 (4853252) | 4853252..4853992 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T296705 WP_004178374.1 NZ_OX359175:c4849789-4849505 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|