Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4084414..4085033 | Replicon | chromosome |
| Accession | NZ_OX359175 | ||
| Organism | Klebsiella pneumoniae strain KP47 isolate 2018-047100-007-01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | ONI05_RS19830 | Protein ID | WP_002892050.1 |
| Coordinates | 4084815..4085033 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | ONI05_RS19825 | Protein ID | WP_002892066.1 |
| Coordinates | 4084414..4084788 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONI05_RS19815 (4079566) | 4079566..4080759 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| ONI05_RS19820 (4080782) | 4080782..4083928 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| ONI05_RS19825 (4084414) | 4084414..4084788 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| ONI05_RS19830 (4084815) | 4084815..4085033 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| ONI05_RS19835 (4085192) | 4085192..4085758 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| ONI05_RS19840 (4085730) | 4085730..4085870 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| ONI05_RS19845 (4085891) | 4085891..4086361 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| ONI05_RS19850 (4086336) | 4086336..4087787 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
| ONI05_RS19855 (4087888) | 4087888..4088586 | + | 699 | WP_032435564.1 | GNAT family protein | - |
| ONI05_RS19860 (4088583) | 4088583..4088723 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| ONI05_RS19865 (4088723) | 4088723..4088986 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296702 WP_002892050.1 NZ_OX359175:4084815-4085033 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT296702 WP_002892066.1 NZ_OX359175:4084414-4084788 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |