Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1758272..1758878 Replicon chromosome
Accession NZ_OX352996
Organism Streptococcus suis isolate 861160_dhsdS

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag QNH80_RS08615 Protein ID WP_012775364.1
Coordinates 1758549..1758878 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag QNH80_RS08610 Protein ID WP_012028535.1
Coordinates 1758272..1758559 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH80_RS08575 1753896..1754255 + 360 WP_004194560.1 ribonuclease P protein component -
QNH80_RS08580 1754239..1755051 + 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
QNH80_RS08585 1755071..1756066 + 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
QNH80_RS08590 1756234..1756371 + 138 WP_002939016.1 50S ribosomal protein L34 -
QNH80_RS08595 1756478..1757260 + 783 WP_012028536.1 TatD family hydrolase -
QNH80_RS08600 1757244..1757813 + 570 WP_012775700.1 ribonuclease M5 -
QNH80_RS08605 1757806..1758174 + 369 WP_012775453.1 hypothetical protein -
QNH80_RS08610 1758272..1758559 + 288 WP_012028535.1 hypothetical protein Antitoxin
QNH80_RS08615 1758549..1758878 + 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNH80_RS08620 1758885..1759340 + 456 WP_074390181.1 8-oxo-dGTP diphosphatase -
QNH80_RS08625 1759416..1759676 + 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QNH80_RS08630 1759678..1759935 + 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
QNH80_RS08635 1759949..1760479 + 531 WP_074390182.1 DUF1697 domain-containing protein -
QNH80_RS08640 1760498..1761370 + 873 WP_024387385.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QNH80_RS08645 1761550..1762023 + 474 WP_024378560.1 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1757244..1784328 27084
- flank IS/Tn - - 1761550..1762023 473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T296689 WP_012775364.1 NZ_OX352996:1758549-1758878 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT296689 WP_012028535.1 NZ_OX352996:1758272-1758559 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References