Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 999147..999821 | Replicon | chromosome |
| Accession | NZ_OX352996 | ||
| Organism | Streptococcus suis isolate 861160_dhsdS | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | QNH80_RS04790 | Protein ID | WP_015647112.1 |
| Coordinates | 999639..999821 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QNH80_RS04785 | Protein ID | WP_074389768.1 |
| Coordinates | 999147..999599 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH80_RS04755 | 995317..996321 | + | 1005 | WP_023370897.1 | lactonase family protein | - |
| QNH80_RS04760 | 996385..996570 | + | 186 | WP_002935693.1 | hypothetical protein | - |
| QNH80_RS04765 | 996603..997244 | - | 642 | WP_023370899.1 | HAD family hydrolase | - |
| QNH80_RS04770 | 997411..997671 | - | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QNH80_RS04775 | 997673..997894 | - | 222 | WP_012775256.1 | DUF6290 family protein | - |
| QNH80_RS04780 | 998824..999033 | - | 210 | WP_015647110.1 | hypothetical protein | - |
| QNH80_RS04785 | 999147..999599 | - | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QNH80_RS04790 | 999639..999821 | - | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QNH80_RS04795 | 1000561..1000974 | - | 414 | WP_024405993.1 | hypothetical protein | - |
| QNH80_RS04800 | 1000992..1001303 | - | 312 | WP_024405994.1 | hypothetical protein | - |
| QNH80_RS04805 | 1001311..1001739 | - | 429 | WP_074389766.1 | replication protein | - |
| QNH80_RS04810 | 1001786..1002397 | - | 612 | WP_024405995.1 | hypothetical protein | - |
| QNH80_RS04815 | 1002489..1002671 | - | 183 | WP_024405996.1 | hypothetical protein | - |
| QNH80_RS04820 | 1003113..1003940 | - | 828 | WP_024381267.1 | ATP-binding protein | - |
| QNH80_RS04825 | 1003950..1004702 | - | 753 | WP_044758031.1 | DnaD domain protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 996385..1008330 | 11945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T296688 WP_015647112.1 NZ_OX352996:c999821-999639 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT296688 WP_074389768.1 NZ_OX352996:c999599-999147 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|